PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g40920.1.p
Common NameLOC104583278
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 396aa    MW: 43228.2 Da    PI: 5.4685
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g40920.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.79.6e-28243292352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i +e+l+kyF++pi++AA+eL+v+lTvLK++CR++G++RWPhRk+ksl
  Bradi2g40920.1.p 243 ENIGFEELRKYFYMPITKAARELNVGLTVLKKRCRELGVARWPHRKMKSL 292
                       699*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541221312IPR003035RWP-RK domain
PfamPF020424.1E-22244292IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MQRYYSGDAD RCFHDPLAPF PLCSSSSSSS SPPSLFTSDE SCLSMAAALF PGDHTGQVED  60
CSSALMLRED ADMTGYLPIS MIPAPAAGDN NGMLYPDNVL PPFPEDLSTV GLDLDLDLLD  120
DALLMLQPLS DIDLEAFGDM DLQVKPEPEP EELNNISVIL PPRALDQSLG PQPQQAAPMQ  180
LHQQNAARHG DSSSIVVSRP AAPAGAVVGI GYAEPQTQQQ RAAPRARRII REGSNAAGGR  240
SLENIGFEEL RKYFYMPITK AARELNVGLT VLKKRCRELG VARWPHRKMK SLRSLILNIQ  300
EMGRGGGVLP PAVQRELEAL ERACTLMEKN PAIELTEQTK KLRQAYFKEN YKKRRAAAVN  360
VLDGCYGGHQ QQLTPMPLPM ISPHSGQSTA FFGRY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7149476e-54JF714947.1 Triticum aestivum cultivar Bobwhite RWP-RK domain containing protein (RKD2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233419.10.0PREDICTED: uncharacterized protein LOC104583278
TrEMBLI1HNI90.0I1HNI9_BRADI; Uncharacterized protein
STRINGBRADI2G40920.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.14e-34RWP-RK domain-containing protein